PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G2520
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 493aa    MW: 55139.5 Da    PI: 7.6415
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G2520genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.21.9e-134390148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed  l+++v+ +G g+W+++ +  g+ R++k+c++rw ++l
      Gh_A11G2520 43 KGPWTGTEDAVLAEYVRSHGEGSWNAVQKNTGLARCGKSCRLRWVNHL 90
                     79*******************************************996 PP

2Myb_DNA-binding45.41.9e-1496139146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE+++++++++++G++ W++ a  ++ gRt +++k++w++
      Gh_A11G2520  96 KGSFSPEEEKIIIELHAKMGNK-WARMATQLP-GRTYNEIKNYWNT 139
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.1183890IPR017930Myb domain
SuperFamilySSF466892.58E-2740137IPR009057Homeodomain-like
SMARTSM007171.4E-104292IPR001005SANT/Myb domain
PfamPF002497.4E-134390IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.5E-224497IPR009057Homeodomain-like
CDDcd001671.60E-84590No hitNo description
PROSITE profilePS5129424.49391145IPR017930Myb domain
SMARTSM007174.7E-1595143IPR001005SANT/Myb domain
PfamPF002491.1E-1396139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2498144IPR009057Homeodomain-like
CDDcd001671.39E-1098139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MMMMMGGNNQ FTTQNEGGEP LGNNGMNNSV VCSGREGGIP LKKGPWTGTE DAVLAEYVRS  60
HGEGSWNAVQ KNTGLARCGK SCRLRWVNHL RPNLKKGSFS PEEEKIIIEL HAKMGNKWAR  120
MATQLPGRTY NEIKNYWNTR VKRRQRQGLP LYPPDVQPFY SQHQHQHRQR HSHPPSPIPS  180
PPPTTAPNSC FSFQTPVVSL HTSNPMPLHP LHIPHRPPPQ NFLYNPHSAL TTPPLPLQSP  240
NSASTPPPLP SPSASTPPHI SPLHSPHNPP PFPTLPLINY PNTTTDDDFF HSNKRFKHDR  300
LQSNNYSNNH LDATSSSFTL PFSPMQHYSN RMILDLPSSS RTTFNHHPHQ DSGDFYPLKM  360
DLRSNQINDD GLLENMLQEA QALAANGSGG NNEIPKETMN AAQNEEDYSR LINIDGPSSF  420
SMAIPEWCND SGESSERQPS AIIDNENHLA LDNHQIASLY PADISPNHAA RSSSVRSWDN  480
FPVLEQSRFL VKI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29381441107B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6159923e-47JX615992.1 Gossypium hirsutum clone NBRI_GE60319 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488302.10.0PREDICTED: myb-like protein A
TrEMBLA0A0D2R2P10.0A0A0D2R2P1_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM51002747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.27e-69myb domain protein 101